Protein coding transcript 80212

• Transcript: Ll_transcript_457499
• CDS coordinates: 2-463 (+)
• Peptide sequence: QHITLIIYGYRQLSGLYKTTLISLLLVSSSFPYTTHLKASMASLMLLHRKLRTTRSFHFHVRVRSFSEKIEKIVIANRGEIACRIMRTAKRLGIRTVAIYSDADKDSLHVHSADEAIRIGPPPPRLSYLNAPSILDAAIRSGAQVNLQFHFNV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_457499

• Blastp: Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial from Soja with 72.07% of identity
• Blastx: Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial from Soja with 72.07% of identity
• Eggnog: carboxylase(COG4770)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441882.1)
• Pfam: Biotin carboxylase, N-terminal domain (PF00289.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;