Protein coding transcript 80215

• Transcript: Ll_transcript_457492
• CDS coordinates: 168-776 (+)
• Peptide sequence: MEMNTRLQVEHPVTEMIVGQDLVEWQIHVANGEALPLSQSQVPISGHAFEARIYAENVPKGFLPATGVLHHYRVPVSSTVRVETGVKEGDTVSMHYDPMIAKLVVHGENRDAALIKLKDCLSKFQVAGLPTNINFLQNLANHRAFGNGNVETHFIDNHKEDLFVDTTNSVSAKEAYSAARLSASFVAACLIEKEHVILARNTP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_457492

• Blastp: Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial from Soja with 88.67% of identity
• Blastx: Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial from Soja with 88.84% of identity
• Eggnog: carboxylase(COG4770)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002402)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441883.1)
• Pfam: Carbamoyl-phosphate synthase L chain, ATP binding domain (PF02786.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;