Transcript | Ll_transcript_277704 |
---|---|
CDS coordinates | 1130-1591 (+) |
Peptide sequence | MHPQPRILCLQGSADGPEQYVAIMNAIFSAQRSTVPIDSCYIGSNNSAFLQQASYITGGIYYKPPQLDGLFQYLSTVFATDLHSRAFLRLPKSLGVDFRASCFCHKQTIDMGYVCSVCLSIFCERHDKCSTCGSVFGQAKQDVTSANSKKRKA* |
ORF Type | complete |
Blastp | RNA polymerase II transcription factor B subunit 4 from Arabidopsis with 79.87% of identity |
---|---|
Blastx | RNA polymerase II transcription factor B subunit 4 from Arabidopsis with 79.75% of identity |
Eggnog | Transcription factor(COG5242) |
Kegg | Link to kegg annotations (AT1G18340) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438573.1) |
Pfam | Transcription factor Tfb4 (PF03850.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer