Protein coding transcript 80267

• Transcript: Ll_transcript_457683
• CDS coordinates: 90-671 (+)
• Peptide sequence: MNFDPSSASSSQALNTIKEISSSSRNIPSDKDFKLCYTSDEFKRPIDEIARKSNSMLQKIGAAKHIWGSEEAGFPVGIDDAYEWLVDVNQEVFGRVDESIKELQKIMKFEDDEMELENGKKKKMKKVKVETKDKEKVSFHISAIEKPQNKYNFLVNNANQPFQHVWLERSDDDQRFIHPLVGFTEHGFVDMLC*
• ORF Type: complete

Annotations of Ll_transcript_457683

• Blastp: Protein RRP6-like 2 from Arabidopsis with 43% of identity
• Blastx: Protein RRP6-like 2 from Arabidopsis with 78.3% of identity
• Eggnog: Exonuclease involved in the 3' processing of various precursor tRNAs. Initiates hydrolysis at the 3'-terminus of an RNA molecule and releases 5'-mononucleotides (By similarity)(COG0349)
• Kegg: Link to kegg annotations (AT5G35910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458438.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;