| Transcript | Ll_transcript_456435 |
|---|---|
| CDS coordinates | 2-331 (+) |
| Peptide sequence | VDIRVGEWSSRRHMNKQKLEELILILGYITALKKLCNHPKLIYDTIRSGNPGTSGFEDCIRFFPPEMLSGRWIVWIIFLRCNFSHTSFKQSFIFLHVEVMLVLLIQHLNQ |
| ORF Type | internal |
| Blastp | Protein CHROMATIN REMODELING 25 from Arabidopsis with 76.47% of identity |
|---|---|
| Blastx | Protein CHROMATIN REMODELING 25 from Arabidopsis with 76.47% of identity |
| Eggnog | helicase(COG0553) |
| Kegg | Link to kegg annotations (AT3G19210) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_006573913.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer