Protein coding transcript 80403

• Transcript: Ll_transcript_457579
• CDS coordinates: 1351-2022 (+)
• Peptide sequence: MGSVCCCFSFDDFEDYVNPNSSVYRNCVCLSCFIQNLLTVYAAIFRRGEVHSVPSSLQGAASMSSTASLDNSLSDMYRSPPRPLPYDAEPRYFRSRREKGSSHLNEESEPLRSDVDIDPESLSSGDKWNECAGEDGSKEYRSKSSLKLSSAKYSTGVGVVYASSEEEDVCPTCLEEYTKENPKIMTKCSHHFHLGCIYEWMERSDNCPVCGKVMVFEETLPLD*
• ORF Type: complete

Annotations of Ll_transcript_457579

• Blastp: E3 ubiquitin-protein ligase At3g02290 from Arabidopsis with 59.57% of identity
• Blastx: E3 ubiquitin-protein ligase At3g02290 from Arabidopsis with 57.83% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT3G02290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428703.1)
• Pfam: RING-H2 zinc finger domain (PF12678.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;