Protein coding transcript 80482

• Transcript: Ll_transcript_458525
• CDS coordinates: 1047-1727 (+)
• Peptide sequence: MLLTSIDTIETHPFSFMPILLPSSPYEFCHSNITKSTCYRIRSEFTRGHIMTRDLLKSDFIWDNVFQPFPYSKRYSQFFKIYLSTSDQFELGNWVGWVKSRFPGLLVILDRVQGFCDPNPTEFVDNEKTEPNVVFYWGWQPVDKNSLVDIELVDGEFMKIVGNGYEGSPGRIELSIIIPSQLPNNAMFDDETIKGKKTCRNTIDDDDDESGALETSLTLSCWPCFT*
• ORF Type: complete

Annotations of Ll_transcript_458525

• Blastp: Nuclear poly(A) polymerase 3 from Arabidopsis with 44.44% of identity
• Blastx: Nuclear poly(A) polymerase 3 from Arabidopsis with 52.56% of identity
• Eggnog: polyA polymerase(COG5186)
• Kegg: Link to kegg annotations (AT3G06560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440147.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;