Transcript | Ll_transcript_458525 |
---|---|
CDS coordinates | 1047-1727 (+) |
Peptide sequence | MLLTSIDTIETHPFSFMPILLPSSPYEFCHSNITKSTCYRIRSEFTRGHIMTRDLLKSDFIWDNVFQPFPYSKRYSQFFKIYLSTSDQFELGNWVGWVKSRFPGLLVILDRVQGFCDPNPTEFVDNEKTEPNVVFYWGWQPVDKNSLVDIELVDGEFMKIVGNGYEGSPGRIELSIIIPSQLPNNAMFDDETIKGKKTCRNTIDDDDDESGALETSLTLSCWPCFT* |
ORF Type | complete |
Blastp | Nuclear poly(A) polymerase 3 from Arabidopsis with 44.44% of identity |
---|---|
Blastx | Nuclear poly(A) polymerase 3 from Arabidopsis with 52.56% of identity |
Eggnog | polyA polymerase(COG5186) |
Kegg | Link to kegg annotations (AT3G06560) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440147.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer