Protein coding transcript 805

• Transcript: Ll_transcript_394246
• CDS coordinates: 2-301 (+)
• Peptide sequence: TKKEIRKIVDVRLEEIQQRLKGNNRDVKIDLSPEVKDYLGAAGYSPAYGARPLARLIEKEVLNRLAVLILRGSIRDGEVARVELEDGHIVVLPNHGDSEG
• ORF Type: internal

Annotations of Ll_transcript_394246

• Blastp: Heat shock protein hsp98 from Neurospora with 73.68% of identity
• Blastx: Heat shock protein hsp98 from Neurospora with 73.68% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (NCU00104)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020996814.1)
• Pfam: C-terminal, D2-small domain, of ClpB protein (PF10431.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;