Transcript | Ll_transcript_457723 |
---|---|
CDS coordinates | 170-1522 (+) |
Peptide sequence | MGEKKRIPMRILPVFLLICISSFQLLHASNDDAIFYESFDETFEDRWIVSQKEEYNGVWKHAKSEGHDDYGLLVSEKARKYAIVKEVDEPVILKDKSVVLQFETRLQDGLECGGAYLKYLRPQEAGWKAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKFPPSVPSDKLSHVYTAILKPNNELQILIDGEEKKRVNFLSSEDFEPVLNPPKTIPDPEDEKPEDWDERAKIPDPSATKPEDWDEDAPLEIVDEEAEKPEGWLDFEPEEIDDPDATKPEDWDDEEDGEWEAPKIDNPKCEAAPGCGEWKRPLKKNPAYKGQWHTPLIDNPDYKGIWKPQEIANPDYFELGKPNFEPIAAIGIEIWTMQDGILFDNILIAKDDKIAASYRETTWKPKFTIEKEKQKEEELETNSAGLAGFQVTSFAVPFFLLLPFSTGF* |
ORF Type | complete |
Blastp | Calnexin homolog from Soja with 79.25% of identity |
---|---|
Blastx | Calnexin homolog from Soja with 74.9% of identity |
Eggnog | Calnexin(ENOG410XP7T) |
Kegg | Link to kegg annotations (547851) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463012.1) |
Pfam | Calreticulin family (PF00262.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer