Protein coding transcript 80580

• Transcript: Ll_transcript_457126
• CDS coordinates: 161-562 (+)
• Peptide sequence: MEKLQNFVAINGGIKLPVGYRFCPTDEELVIHYLKRKVFAEPLPGSVISDFDVFHTVPWNLPGWLIGWFVAANCVFSLKFISLVLYRCWVFVSLLGYKVMKEQSLQKKSFFLLLKWGIETDACYHSSKEFDFL*
• ORF Type: complete

Annotations of Ll_transcript_457126

• Blastp: NAC domain-containing protein 83 from Arabidopsis with 61.82% of identity
• Blastx: NAC domain-containing protein 83 from Arabidopsis with 41.07% of identity
• Eggnog: nac domain(ENOG410YED8)
• Kegg: Link to kegg annotations (AT5G13180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433246.1)
• Pfam: No apical meristem (NAM) protein (PF02365.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;