Transcript | Ll_transcript_457142 |
---|---|
CDS coordinates | 269-787 (+) |
Peptide sequence | MERLQNFGALKLPVGYRFCPTDEELVTHYLKRKVFAEPLPVSVIPDFDVFHTLPWDLQGDSKEKMYFFSNRKGYVCGNSSRIVVGSGYWKSIGKDKAIVASDSRQVIGMRKTLIYSKGKHSNETKTQWVMHELCLVGSGESSYPFQVITKLKRLTIITIKLSIFSVIPFEFS* |
ORF Type | complete |
Blastp | NAC domain-containing protein 41 from Arabidopsis with 53.57% of identity |
---|---|
Blastx | NAC domain-containing protein 41 from Arabidopsis with 53.57% of identity |
Eggnog | NAC domain containing protein 41(ENOG41107S8) |
Kegg | Link to kegg annotations (AT2G33480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433246.1) |
Pfam | No apical meristem (NAM) protein (PF02365.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer