Protein coding transcript 8067

• Transcript: Ll_transcript_277925
• CDS coordinates: 1097-1516 (+)
• Peptide sequence: MFIGGLVPFSAIVLQLHQVYASMWGYKIYTLPSILFVTFITAVVIIVLVNTGLTYIQLSAEDHEWWWRSVLSGGSTAIFMFGYCIYFYVRSNMNGFLQLFFFLGYNACICYAFFLIFGAISFRVSLLFVRHIYHNVKRE*
• ORF Type: complete

Annotations of Ll_transcript_277925

• Blastp: Transmembrane 9 superfamily member 5 from Arabidopsis with 61.87% of identity
• Blastx: Transmembrane 9 superfamily member 5 from Arabidopsis with 56.99% of identity
• Eggnog: transmembrane 9 superfamily member(ENOG410XSVB)
• Kegg: Link to kegg annotations (AT1G08350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448830.1)
• Pfam: Endomembrane protein 70 (PF02990.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;