Transcript | Ll_transcript_394239 |
---|---|
CDS coordinates | 2-328 (+) |
Peptide sequence | SPSVLAGFKKLDQIKTEEDLLPPGAQPGTVPTDAEQATGLERLEILGKMQGIDIFDMRPLDASRLGTMEDPITVNSAGNEQYVGCTGFPADSHNVLWITLTREEPKSRC |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | Cytochrome c oxidase subunit 4, mitochondrial from Neurospora with 74.51% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (NCU05689) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_013454691.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer