Protein coding transcript 808

• Transcript: Ll_transcript_394225
• CDS coordinates: 1-372 (+)
• Peptide sequence: VFIGKHFFGLDKFPSISFDYGYFLYQWAFAIAAAGITSGSIAERTQFVSYLIYSSFLTGLVYPIVSHWFWSPDGWGSPARSENLLFGTGVIDFAGSGVVHLVGAVAGFWGAFIEGPRMGRFDHE
• ORF Type: internal

Annotations of Ll_transcript_394225

• Blastp: Ammonium transporter 1 member 4 from Arabidopsis with 84.17% of identity
• Blastx: Ammonium transporter 1 member 4 from Arabidopsis with 84.17% of identity
• Eggnog: ammonium Transporter(COG0004)
• Kegg: Link to kegg annotations (AT4G28700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460069.1)
• Pfam: Ammonium Transporter Family (PF00909.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;