Protein coding transcript 80943

• Transcript: Ll_transcript_456791
• CDS coordinates: 1961-2839 (+)
• Peptide sequence: MIEKIHEVKTAELRLSKPDILEETNDNQPYKLCAICHSLGGAAILMYVITRRLQDKPHRLSRLVLLSPAGFHFDSNIVFSVVELLLILLAPVLSPLVPAFYIPTRFFRMIVFKLAQDLHNLPAVGGLVQTLMSYVVGGDSSNWVGVLGLPHYNMNDMPGVSFRVAIHLAQMKRSGKFRMFDYGSQSVNMRVYGSPEPLDLGENYGLINIPVDLVAGQKDKVIRPSMVKRHYKLMKDASVNVSYNEFEYAHLDFTFSHREELLSYVMSRLLLVNPKSQRAARSRKTGQAATSM*
• ORF Type: complete

Annotations of Ll_transcript_456791

• Blastp: Lipase member M from Homo with 25.62% of identity
• Blastx: Lipase member M from Homo with 24.06% of identity
• Eggnog: Alpha beta hydrolase(COG0596)
• Kegg: Link to kegg annotations (340654)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458655.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;