Protein coding transcript 81025

• Transcript: Ll_transcript_458227
• CDS coordinates: 83-604 (+)
• Peptide sequence: MKKMMGLTAILLRSTTTTAVFFYLLISSVHSFYLPGVAPRDFLTGDPLSVKVNKLSSTKTQLPYDYYYLKYCKPSKIVNNAENLGEVLRGDRIENSIYAFQMRKEQSCTVVCHVTLDAESAKNFKEKIDDEYRVNMILDNLPVAVLRQRRDGSQSTTYEHGFRVGFKGNYQGV*
• ORF Type: complete

Annotations of Ll_transcript_458227

• Blastp: Transmembrane 9 superfamily member 7 from Arabidopsis with 83.8% of identity
• Blastx: Transmembrane 9 superfamily member 7 from Arabidopsis with 83.8% of identity
• Eggnog: transmembrane 9 superfamily(ENOG410XPIW)
• Kegg: Link to kegg annotations (AT3G13772)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424649.1)
• Pfam: Endomembrane protein 70 (PF02990.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;