Protein coding transcript 81034

• Transcript: Ll_transcript_458109
• CDS coordinates: 80-598 (+)
• Peptide sequence: MIPFPPPHLFFFLWFLLPIPFTQSESSTCLTVYNSGGAPAVFQSPKCPRWKLSDYDSPSQSTARCHNAILQGRRISQEDRTLCLQDLHIPFPGVNGIKEVVVGIVAVFDGHNGAEASDTASKLLVEYFVLHTYFLIDAAYSVMFKTSMGAWPHKRDRDWVNMLQRWKELYNER
• ORF Type: 3prime_partial

Annotations of Ll_transcript_458109

• Blastp: Probable protein phosphatase 2C 51 from Arabidopsis with 62.14% of identity
• Blastx: Probable protein phosphatase 2C 51 from Arabidopsis with 63.97% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G63340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452686.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;