Transcript | Ll_transcript_457240 |
---|---|
CDS coordinates | 1567-2370 (+) |
Peptide sequence | MAMNEKFKKDEVWGDLGKSNKSHLKEKDGEENSLDEDYIQDGDNDDSSNFKPVYNKDDFFDSLSSNALDRASQNGRIRYSEQIKIDTETFGDFARHRGGRGGRGPSNGGRGGRGPSNGGRGGRDLSGGGRGGRDPSDGGRGGRGPSDGGRGGRGPSDGGRGGRGRSDGGRGGRGPSDGYRGGHSPSDGGRGGRGPSTGGIGGRGPSTDGSGAPPSRGGRGGHGPSRGGRGVDGPSRGGRGDDGPYRGGHHSRGDYGGRGCGIPSHSS* |
ORF Type | complete |
Blastp | Protein decapping 5 from Arabidopsis with 58.95% of identity |
---|---|
Blastx | Protein decapping 5 from Arabidopsis with 60.95% of identity |
Eggnog | LSM14A, SCD6 homolog A (S. cerevisiae)(ENOG41122RA) |
Kegg | Link to kegg annotations (AT1G26110) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429846.1) |
Pfam | FDF domain (PF09532.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer