Protein coding transcript 81205

• Transcript: Ll_transcript_457249
• CDS coordinates: 1567-1980 (+)
• Peptide sequence: MAMNEKFKKDEVWGDLGKSNKSHLKEKDGEENSLDEDYIQDGDNDDSSNFKPVYNKDDFFDSLSSSALDQASHNGRIRYSEQIKIDTETFGNFVRPRGGRGGRGPFRGGHLSRGGYYGRGYGYSGRGRGRGMPSHNS*
• ORF Type: complete

Annotations of Ll_transcript_457249

• Blastp: Protein decapping 5 from Arabidopsis with 43.41% of identity
• Blastx: Protein decapping 5 from Arabidopsis with 58.25% of identity
• Eggnog: LSM14A, SCD6 homolog A (S. cerevisiae)(ENOG41122RA)
• Kegg: Link to kegg annotations (AT1G26110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429846.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;