| Transcript | Ll_transcript_457253 |
|---|---|
| CDS coordinates | 1-312 (+) |
| Peptide sequence | EDYSLDEDNEDSSNFKQPVYNKDDFFDSLSSNALDRASQNGRIRYSEQIKIDTETFGDFARHRGGRGGRGPFRGGYPSRGGYYGRGYGYSGRGRGRGMPSHNS* |
| ORF Type | 5prime_partial |
| Blastp | Protein decapping 5 from Arabidopsis with 75.56% of identity |
|---|---|
| Blastx | Protein decapping 5 from Arabidopsis with 75.56% of identity |
| Eggnog | LSM14A, SCD6 homolog A (S. cerevisiae)(ENOG41122RA) |
| Kegg | Link to kegg annotations (AT1G26110) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019461367.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer