Protein coding transcript 81213

• Transcript: Ll_transcript_457250
• CDS coordinates: 1174-1866 (+)
• Peptide sequence: MPMYWQGYYGAPNGLPNFHQQSLLRPPPGLLMPPSMQHPMQYPNFSLSLSSGSSNLPELPSSLLQVSNSTSSVTSASLSPSNLYPAPSSLPEAPSALPVAPSVLLPALSALPPTPSTLSHAPSASLAFETFPLSLTDKAPNVSLPSVTPAANLPSLTPLTNSGSEMNATVPPISSKPNAISGSSLAFQTVSQLSPSVVGSSNSISTETPVPSLVTPGQLLQPGSTVVSSVH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_457250

• Blastp: Protein decapping 5 from Arabidopsis with 43.16% of identity
• Blastx: Protein decapping 5 from Arabidopsis with 84.52% of identity
• Eggnog: LSM14A, SCD6 homolog A (S. cerevisiae)(ENOG41122RA)
• Kegg: Link to kegg annotations (AT1G26110)
• CantataDB: Link to cantataDB annotations (CNT0001887)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461368.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;