Protein coding transcript 81311

• Transcript: Ll_transcript_457289
• CDS coordinates: 864-1166 (+)
• Peptide sequence: MVGIGKRSLTVSALRLRWSIEKRHVPYFFRTSKTGDENGLVLGITIPSASISTKILVIASFWEYGYRYGLTLIGEELGSKVIWWSCGRVDGRPCGVWNTF*
• ORF Type: complete

Annotations of Ll_transcript_457289

• Blastp: Uncharacterized mitochondrial protein AtMg00860 from Arabidopsis with 45.1% of identity
• Blastx: Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 44.87% of identity
• Eggnog: Retrotransposon protein(COG2801)
• Kegg: Link to kegg annotations (ArthMp075)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020222267.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;