Transcript | Ll_transcript_457289 |
---|---|
CDS coordinates | 864-1166 (+) |
Peptide sequence | MVGIGKRSLTVSALRLRWSIEKRHVPYFFRTSKTGDENGLVLGITIPSASISTKILVIASFWEYGYRYGLTLIGEELGSKVIWWSCGRVDGRPCGVWNTF* |
ORF Type | complete |
Blastp | Uncharacterized mitochondrial protein AtMg00860 from Arabidopsis with 45.1% of identity |
---|---|
Blastx | Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 44.87% of identity |
Eggnog | Retrotransposon protein(COG2801) |
Kegg | Link to kegg annotations (ArthMp075) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020222267.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer