Transcript | Ll_transcript_456504 |
---|---|
CDS coordinates | 113-652 (+) |
Peptide sequence | MATTQLSKKRKFVADGVFFAELNEVLTRELAEDGYSGVEVRVTPMRTEIIIRATRTQAVLGEKGRRIRELTSVVQKRFKFQENTVELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGQPVKAYIDSALRHVLLRQ |
ORF Type | 3prime_partial |
Blastp | 40S ribosomal protein S3-2 from Arabidopsis with 92.7% of identity |
---|---|
Blastx | 40S ribosomal protein S3-2 from Arabidopsis with 92.7% of identity |
Eggnog | Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation (By similarity)(COG0092) |
Kegg | Link to kegg annotations (AT3G53870) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433727.1) |
Pfam | KH domain (PF07650.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer