Protein coding transcript 81382

• Transcript: Ll_transcript_456504
• CDS coordinates: 113-652 (+)
• Peptide sequence: MATTQLSKKRKFVADGVFFAELNEVLTRELAEDGYSGVEVRVTPMRTEIIIRATRTQAVLGEKGRRIRELTSVVQKRFKFQENTVELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGQPVKAYIDSALRHVLLRQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_456504

• Blastp: 40S ribosomal protein S3-2 from Arabidopsis with 92.7% of identity
• Blastx: 40S ribosomal protein S3-2 from Arabidopsis with 92.7% of identity
• Eggnog: Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation (By similarity)(COG0092)
• Kegg: Link to kegg annotations (AT3G53870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433727.1)
• Pfam: KH domain (PF07650.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;