Protein coding transcript 81388

• Transcript: Ll_transcript_456505
• CDS coordinates: 2-460 (+)
• Peptide sequence: SVELYAEKVATRGLCAIAQAESLRYKLIGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGEPTNDYVDTATRHVLLRQGVLGIKVKIMLPWDPNGKTGPKKPLPDNVSVVEPKEEILPSVPSSDVKASKPDAAP
• ORF Type: internal

Annotations of Ll_transcript_456505

• Blastp: 40S ribosomal protein S3 from Ictalurus with 88.67% of identity
• Blastx: 40S ribosomal protein S3 from Ictalurus with 88.67% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (100304557)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020235968.1)
• Pfam: Ribosomal protein S3, C-terminal domain (PF00189.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;