Protein coding transcript 81415

• Transcript: Ll_transcript_458144
• CDS coordinates: 71-628 (+)
• Peptide sequence: MFIQTISRSLSLRLSLLHHRRLLSTTSPFSSLPTLFLRPFLSPISPSAQLAPVRCHSTRPGGNSAYSPLNNSGGGSNFSDRPPTEMAPLFPGCDYQHWLIVMDKPGGEGASKQQMIDCYVQTLAKVLGSEEEAKQKIYNVSCERYFGFGCEIDEETSNKLEGLPGVLFVLPDSYVDPEYKDYGGI*
• ORF Type: complete

Annotations of Ll_transcript_458144

• Blastp: Multiple organellar RNA editing factor 5, chloroplastic/mitochondrial from Arabidopsis with 63.49% of identity
• Blastx: Multiple organellar RNA editing factor 2, chloroplastic from Arabidopsis with 78.08% of identity
• Eggnog: DAG protein(ENOG410YAFM)
• Kegg: Link to kegg annotations (AT1G32580)
• CantataDB: Link to cantataDB annotations (CNT0000703)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432503.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;