Protein coding transcript 81416

• Transcript: Ll_transcript_458156
• CDS coordinates: 71-763 (+)
• Peptide sequence: MFIQTISRSLSLRLSLLHHRRLLSTTSPFSSLPTLFLRPFLSPISPSAQLAPVRCHSTRPGGNSAYSPLNNSGGGSNFSDRPPTEMAPLFPGCDYQHWLIVMDKPGGEGASKQQMIDCYVQTLAKVLGSEEEAKQKIYNVSCERYFGFGCEIDEETSNKLEGLPGVLFVLPDSYVDPEYKDYGAELFVNGEIVQRSPERQRRVEPQPQRHQDRPRYNDRTRYVRRRENTR*
• ORF Type: complete

Annotations of Ll_transcript_458156

• Blastp: Multiple organellar RNA editing factor 2, chloroplastic from Arabidopsis with 84.78% of identity
• Blastx: Multiple organellar RNA editing factor 2, chloroplastic from Arabidopsis with 82.19% of identity
• Eggnog: DAG protein(ENOG410YAFM)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000703)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432503.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;