Protein coding transcript 81417

• Transcript: Ll_transcript_458145
• CDS coordinates: 154-762 (+)
• Peptide sequence: MASRSLWSSSSTRLSTLLTMRLFSSTATTASITKPPSLTSLILPRRRPLLPLSNAIILPQTTRFGGIRCRVNRAGDSAYSPINSGSSFSDRPPTEMAPLFPGCDYQHWLIVMDKPGGEGATKQQMIDCYVQTLAKVLGSVEEAIKKIYNVSCERYFGFGCEIDEETSNKLEGLPGVLFVLPDSYVDPEYKDYGGKDLSLTLS*
• ORF Type: complete

Annotations of Ll_transcript_458145

• Blastp: Multiple organellar RNA editing factor 6, mitochondrial from Arabidopsis with 67.96% of identity
• Blastx: Multiple organellar RNA editing factor 6, mitochondrial from Arabidopsis with 81.88% of identity
• Eggnog: NA(ENOG41106XY)
• Kegg: Link to kegg annotations (AT2G35240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020210354.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;