Protein coding transcript 81419

• Transcript: Ll_transcript_458158
• CDS coordinates: 184-903 (+)
• Peptide sequence: MATTTTTKILWPCSSTRISTLLTMRLFSTTTTATSIIKPPPLPFLSLPIRRSLLPLSNATTRFGGIRCRVNRAGDSAYSPINSGSSFSDRPPTEMAPLFPGCDYQHWLIVMDKPGGEGATKQQMIDSYVQTLAKVLGSEEEAIKKIYNVSCERYFGFGCEIDEETSNKLEGLPGVLFVLPDSYVDPEYKDYGAELFVNGEIVQRSPERQRRVEPQPQRHQDRPRYNDRTRYVRRRENMR*
• ORF Type: complete

Annotations of Ll_transcript_458158

• Blastp: Multiple organellar RNA editing factor 2, chloroplastic from Arabidopsis with 74.89% of identity
• Blastx: Multiple organellar RNA editing factor 2, chloroplastic from Arabidopsis with 86.62% of identity
• Eggnog: DAG protein(ENOG410YAFM)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014514708.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;