Protein coding transcript 81538

• Transcript: Ll_transcript_531877
• CDS coordinates: 546-1376 (+)
• Peptide sequence: MNLLRQGLNYLIDGSKDARVGLLFTASQSTDFSSLLFVKVFEITTSSYSHKKNILDFLDQLCSFYEQKYVVTSVSEVDNTQAFIDKVCELAEANGLPSKGYRSTLIEFPAEEVRKHLSKVEKFVNRVLGIESGGNAVFSNGRVTYPVGERTLLSADLHLLELIEFKQRTKHIVEIIEEVKWLDVDPDMLTSKFISDIIMALSSTMATRERNSDGARFEILNDQHSAIILQSENSSIHIDAVLDPLSPTSQKLSGILRVLWKYVQPSMRIVLNPLVG*
• ORF Type: complete

Annotations of Ll_transcript_531877

• Blastp: UDP-glucose:glycoprotein glucosyltransferase from Arabidopsis with 58.39% of identity
• Blastx: UDP-glucose:glycoprotein glucosyltransferase from Arabidopsis with 57.1% of identity
• Eggnog: udp-glucose glycoprotein glucosyltransferase(ENOG410XRK6)
• Kegg: Link to kegg annotations (AT1G71220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425825.1)
• Pfam: UDP-glucose:Glycoprotein Glucosyltransferase (PF06427.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;