Protein coding transcript 81615

• Transcript: Ll_transcript_532184
• CDS coordinates: 1-405 (+)
• Peptide sequence: EKLMNARVVYLGEAEQVPVRDDKELELEIVKKLHKMCLENHKLLSLALETFPSNLQPQLNQYLDNKIDGETLKSYTLHWPPERWQEYEPILNYCRENGIRLVACGTPLAAKLGGSDKYQTLNATCKLTYNMHKF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_532184

• Blastp: Protein RETICULATA-RELATED 6, chloroplastic from Arabidopsis with 70.37% of identity
• Blastx: Protein RETICULATA-RELATED 6, chloroplastic from Arabidopsis with 70.37% of identity
• Eggnog: Domain of unknown function (DUF3411)(ENOG410YH33)
• Kegg: Link to kegg annotations (AT3G56140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415198.1)
• Pfam: Haem-binding uptake, Tiki superfamily, ChaN (PF04187.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;