| Transcript | Ll_transcript_531760 |
|---|---|
| CDS coordinates | 684-1016 (+) |
| Peptide sequence | MYVVLNVTKCVVFLIMFTAGSQKDESSSRFQDTEIQLFVQTKYISIYICFLLPIPNSFCLMLTLLFVIMAGNKVNNIDVVYTPWANLKKTPSMDVGQVGFHNSKMVTKYT* |
| ORF Type | complete |
| Blastp | Coiled-coil domain-containing protein 25 from Silurana with 64.29% of identity |
|---|---|
| Blastx | Coiled-coil domain-containing protein 25 from Bos with 67.07% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (448037) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019417459.1) |
| Pfam | - |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer