Protein coding transcript 81637

• Transcript: Ll_transcript_531762
• CDS coordinates: 85-639 (+)
• Peptide sequence: MVFYFKARSEAGDYTIFMGLDKYENEELIRYGFPEDIWFHVDKMSSAHVYVRLHKGQTVDDISEGLLEDCVQLVKANSIQGNKVNNIDVVYTPWSNLKKTPSMDVGQVGFHNSKMVRTVRVEKRINEIVNRLNKTKVERKPDLKAESEAVNVAERAERKLHLREKKRHEDLERLEKEKQAEMRSY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_531762

• Blastp: Coiled-coil domain-containing protein 25 from Bos with 62.37% of identity
• Blastx: Coiled-coil domain-containing protein 25 from Bos with 62.37% of identity
• Eggnog: Coiled-coil domain-containing protein(ENOG410Z5JK)
• Kegg: Link to kegg annotations (507275)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438409.1)
• Pfam: Domain of unknown function (DUF814) (PF05670.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;