Transcript | Ll_transcript_531766 |
---|---|
CDS coordinates | 208-855 (+) |
Peptide sequence | MVFYFKARPEVGDYSIFMGLDKYENEELIKYGFPEDIWFHVDKMSSAHVYVRLHKGQTIDDISEGLLEDCVQLVKANSIQGNKVNNIDVVYTPWSNLKKTPSMDVGQVGFHNSKMVRTVRVEKRINEIVNRLNKTKVERKPDLKAESEAVNVAERAERKLHLREKKRHEDLERLEKEKQAEMRSYKGLMVSENMTSNKQIASGSKSLQELEEDFM* |
ORF Type | complete |
Blastp | Coiled-coil domain-containing protein 25 from Bos with 61.81% of identity |
---|---|
Blastx | Coiled-coil domain-containing protein 25 from Bos with 61.81% of identity |
Eggnog | Coiled-coil domain-containing protein(ENOG410Z5JK) |
Kegg | Link to kegg annotations (507275) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438409.1) |
Pfam | Domain of unknown function (DUF814) (PF05670.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer