Protein coding transcript 81645

• Transcript: Ll_transcript_531773
• CDS coordinates: 246-1076 (+)
• Peptide sequence: MEDSDGVLNFDFEGTLDAAPLPSITATVSAPSGPLIHHDASSVASSIPNANSLAITPHSASDHASANVQGRRSFRQTVCRHWLRSLCMKGDACGFLHQYDKARMPVCRFFRLYGECREQDCVYKHTNEDIKECNMYKLGFCPNGPDCRYRHAKFPGPPPPVEEILQKIQHLYSYNYNGPNKTFQQRGASYNQQVERSQFPQGVNSTNQGVAAKPLVAEPGNAQQQQQVQQSQQQVNQSQMQSPANGQPNQANRTAIPLPQGISRSVQSLVVFNRAR*
• ORF Type: complete

Annotations of Ll_transcript_531773

• Blastp: 30-kDa cleavage and polyadenylation specificity factor 30 from Arabidopsis with 58.8% of identity
• Blastx: 30-kDa cleavage and polyadenylation specificity factor 30 from Arabidopsis with 58.8% of identity
• Eggnog: zinc finger(COG5084)
• Kegg: Link to kegg annotations (AT1G30460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440105.1)
• Pfam: RNA-binding, Nab2-type zinc finger (PF14608.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;