Transcript | Ll_transcript_531773 |
---|---|
CDS coordinates | 246-1076 (+) |
Peptide sequence | MEDSDGVLNFDFEGTLDAAPLPSITATVSAPSGPLIHHDASSVASSIPNANSLAITPHSASDHASANVQGRRSFRQTVCRHWLRSLCMKGDACGFLHQYDKARMPVCRFFRLYGECREQDCVYKHTNEDIKECNMYKLGFCPNGPDCRYRHAKFPGPPPPVEEILQKIQHLYSYNYNGPNKTFQQRGASYNQQVERSQFPQGVNSTNQGVAAKPLVAEPGNAQQQQQVQQSQQQVNQSQMQSPANGQPNQANRTAIPLPQGISRSVQSLVVFNRAR* |
ORF Type | complete |
Blastp | 30-kDa cleavage and polyadenylation specificity factor 30 from Arabidopsis with 58.8% of identity |
---|---|
Blastx | 30-kDa cleavage and polyadenylation specificity factor 30 from Arabidopsis with 58.8% of identity |
Eggnog | zinc finger(COG5084) |
Kegg | Link to kegg annotations (AT1G30460) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440105.1) |
Pfam | RNA-binding, Nab2-type zinc finger (PF14608.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer