Transcript | Ll_transcript_533565 |
---|---|
CDS coordinates | 767-1405 (+) |
Peptide sequence | MAAQLVWTPIDVVSQRIMVQGCNSSTNTKNIVNNLNSENYRNGFDAFRKILCADGAKGLYRGFGISILTYAPSNAVWWTSYSVVHRLIWDAFGSYMGKRDDGNLVNRGYGFRPDSKAMVAVQGLSAVMASGVSAIMTMPFDTVKTRLQVLDSEESGRRKPLTFVQTVKNLVNEGGLHACYRGLGPRWVSMSMSATTMITTYEFLKRMSTKSN* |
ORF Type | complete |
Blastp | Solute carrier family 25 member 44 from Mus with 28.84% of identity |
---|---|
Blastx | Solute carrier family 25 member 44 from Mus with 28.66% of identity |
Eggnog | Solute carrier family 25 member(ENOG410XTGQ) |
Kegg | Link to kegg annotations (229517) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437833.1) |
Pfam | Mitochondrial carrier protein (PF00153.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer