Protein coding transcript 81669

• Transcript: Ll_transcript_532928
• CDS coordinates: 180-560 (+)
• Peptide sequence: MDDYKPIATPMGSGTYIDADEPGKCIDISKYRGMIGSLLYLTASRPDIMFSVCLCACYQSKPKKSHLVAVKRILKYLKGTTDVGLWYPKGSICELVGYSDSDFARCKSERKSTSGTCHILGNALVSW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_532928

• Blastp: Uncharacterized mitochondrial protein AtMg00810 from Arabidopsis with 37.01% of identity
• Blastx: Uncharacterized mitochondrial protein AtMg00810 from Arabidopsis with 34.81% of identity
• Eggnog: Retrotransposon protein(COG2801)
• Kegg: Link to kegg annotations (ArthMp070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016192204.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;