Protein coding transcript 81691

• Transcript: Ll_transcript_532534
• CDS coordinates: 143-601 (+)
• Peptide sequence: MASGEEESGEFYLRYYVGHKGKFGHEFLEFEFRSDGKLRYANNSNYKNDTIIRKEVYLTPAVLRECRRIISQSEIMKEDDNNWPEPDRVGRQELEIVMGNEHISFTTSKIGSLMDVQNSADPEGLRIFYYLVQDLKCFVFSLISLHFKIKPI*
• ORF Type: complete

Annotations of Ll_transcript_532534

• Blastp: Protein mago nashi homolog 2 from Oryza sativa with 87.58% of identity
• Blastx: Protein mago nashi homolog 2 from Oryza sativa with 87.58% of identity
• Eggnog: Mago nashi(ENOG4111FJ7)
• Kegg: Link to kegg annotations (4351998)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443021.1)
• Pfam: Mago nashi protein (PF02792.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;