Protein coding transcript 81693

• Transcript: Ll_transcript_532541
• CDS coordinates: 207-698 (+)
• Peptide sequence: MASSRLALVLFMCALPAMIAAIRPEKNPFSVTGRVFCDPCRATFETSATTYIAGAEVELQCTDRATNEVVYTQKGITDSTGTYAITVNEDHKDQVCNAKLVKSNHPTCNEATPGRDASRVILTGYNGIATNKRFANAMGYMTKEVASGCADVLKLYQQLDEDN*
• ORF Type: complete

Annotations of Ll_transcript_532541

• Blastp: Protein DOWNSTREAM OF FLC from Arabidopsis with 42.33% of identity
• Blastx: Protein DOWNSTREAM OF FLC from Arabidopsis with 42.33% of identity
• Eggnog: pollen Ole e 1 allergen and extensin family protein(ENOG411144F)
• Kegg: Link to kegg annotations (AT5G10130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417291.1)
• Pfam: Pollen proteins Ole e I like (PF01190.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;