Protein coding transcript 81745

• Transcript: Ll_transcript_533433
• CDS coordinates: 3-422 (+)
• Peptide sequence: LISLMSNHQTPHFLSNLQQHKHHFSLHPPLFLSVSEMKISFSSTTIIIFIILFIFFFASVNSNVQSHSLQPKNPSRNIHNHLRYCDSFSRRNPRSLCIELQKMHHGLNAPVPPSMKNGIDPRYGVEKRLVPSGPNPLHN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_533433

• Blastp: CLAVATA3/ESR (CLE)-related protein 10 from Arabidopsis with 45.83% of identity
• Blastx: CLAVATA3/ESR (CLE)-related protein 9 from Arabidopsis with 61.29% of identity
• Eggnog: clavata3 esr-related(ENOG41112ZV)
• Kegg: Link to kegg annotations (AT1G69320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020218054.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;