| Transcript | Ll_transcript_533677 |
|---|---|
| CDS coordinates | 2431-2739 (+) |
| Peptide sequence | MTNFVLHVPAIFGRFTVSASSNSNGVSRGGGPMIVELPLEKIRRPMLRTRTNDPDKVQQLMDSVSEIGLQVPVSLVVTATRLTSALDSQPFVVKYVAALRRL* |
| ORF Type | complete |
| Blastp | Sulfiredoxin, chloroplastic/mitochondrial from Arabidopsis with 68.89% of identity |
|---|---|
| Blastx | Sulfiredoxin, chloroplastic/mitochondrial from Arabidopsis with 91.18% of identity |
| Eggnog | sulfiredoxin(COG5119) |
| Kegg | Link to kegg annotations (AT1G31170) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019434857.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer