| Transcript | Ll_transcript_333746 |
|---|---|
| CDS coordinates | 2-313 (+) |
| Peptide sequence | NTAGGQTKEIGVGDALESIKLEEFTEIHKKPCVRDALMTGIGSGFGIGGVRALIGAKVWTSCNWAVGAWVVGSVGMYQYCQYKRQMEKEGMTRAMEILSKKDME |
| ORF Type | internal |
| Blastp | Cytochrome c oxidase protein 20, mitochondrial from Schizosaccharomyces with 24.18% of identity |
|---|---|
| Blastx | - |
| Eggnog | - |
| Kegg | Link to kegg annotations (SPBC25H2.18) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_014627180.1) |
| Pfam | Protein of unknown function (DUF3767) (PF12597.7) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer