Protein coding transcript 81800

• Transcript: Ll_transcript_533668
• CDS coordinates: 118-495 (+)
• Peptide sequence: MANFVLHFPVNLRCFTVSASSSSNGAPPGGSGSGGGGGPVIVELPLDKIRRPLLRTRTNDPNKVQQLMDSISEIGLQVPIDVLEVDGIYYGFSGCHRYEAHQRLGLPTIRCKIRRGTKETLRHHMR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_533668

• Blastp: Sulfiredoxin, chloroplastic/mitochondrial from Arabidopsis with 73.02% of identity
• Blastx: Sulfiredoxin, chloroplastic/mitochondrial from Arabidopsis with 73.02% of identity
• Eggnog: sulfiredoxin(COG5119)
• Kegg: Link to kegg annotations (AT1G31170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434857.1)
• Pfam: ParB-like nuclease domain (PF02195.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;