Transcript | Ll_transcript_531810 |
---|---|
CDS coordinates | 131-802 (+) |
Peptide sequence | MFPYNHFDFLDQHPSNLDILSSSLISDGASGSRPAAVSDEEVLLAASHPKKRAGRKKFKETRHPVYRGVRRRNSGKWVCEVREPNKKTRIWLGTFPTAEMAARAHDVAAIALRGKSACLNFADSAWRLPVPATSEAKDIQKAAAEAAKAFGPVADEGRLANEVAVTSAAATMVEEQEEESSTVPEWLRNMVLMSPTHYNVGSEYGCVDVEFDDAEVSLWNYSI* |
ORF Type | complete |
Blastp | Dehydration-responsive element-binding protein 1C from Arabidopsis with 58.67% of identity |
---|---|
Blastx | Dehydration-responsive element-binding protein 1D from Arabidopsis with 85.71% of identity |
Eggnog | dehydration-responsive element-binding protein(ENOG410YK37) |
Kegg | Link to kegg annotations (AT4G25470) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452833.1) |
Pfam | AP2 domain (PF00847.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer