Transcript | Ll_transcript_533078 |
---|---|
CDS coordinates | 203-748 (+) |
Peptide sequence | MASHVGPYSLSVFHSTHYSGLDLIMKFGPNEPWKKVFGPMFIYLNSLSNGENPITLWKDAKKQLVDEAESWPYTFPASKELLSSKQRGKVQGRLLVQDRYIKDASIPVSGGYVGLASPGNAGSWQRESKGYQFWTTTDDKGYFSIINIRPGNYNLYSWVIGYIGDYKYGSIINITSGSNINV |
ORF Type | 3prime_partial |
Blastp | Rhamnogalacturonate lyase from Dickeya with 24.05% of identity |
---|---|
Blastx | Rhamnogalacturonate lyase from Dickeya with 25.24% of identity |
Eggnog | Rhamnogalacturonate lyase(ENOG410YE12) |
Kegg | Link to kegg annotations (Dda3937_01465) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417439.1) |
Pfam | Polysaccharide lyase family 4, domain II (PF14686.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer