Protein coding transcript 819

• Transcript: Ll_transcript_325423
• CDS coordinates: 1-306 (+)
• Peptide sequence: NWFNQNVKPLSQRKNTLDPALIAAEKAARVIKVMQNGKGNFKTITEAIKSIPKGNTKRVIIYIGSGTYVEKIRIEREKPFITFYGAPGSMPNLTYGGTALKY
• ORF Type: internal

Annotations of Ll_transcript_325423

• Blastp: Pectinesterase PPME1 from Arabidopsis with 62.38% of identity
• Blastx: Pectinesterase PPME1 from Arabidopsis with 62.38% of identity
• Eggnog: pectinesterase(COG4677)
• Kegg: Link to kegg annotations (AT1G69940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454699.1)
• Pfam: Pectinesterase (PF01095.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;