Protein coding transcript 81909

• Transcript: Ll_transcript_532640
• CDS coordinates: 1-495 (+)
• Peptide sequence: GWDSVMRMDANLRDLFIYEAFLYYNPLLLVTMMVWLWGVNLWVFLQSSVSYPKIFGIDQNHLSHNEIWKCSTWMTIIVPTSMTTYLYLYSHGEVSLAASQPVLLYIVVAVVLIFPFDIFFLSSRFFFLRTLWRIAFPLQPITFPDFFVADILTSMAKVQQIGLC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_532640

• Blastp: SPX and EXS domain-containing protein 5 from Dictyostelium with 29.71% of identity
• Blastx: -
• Eggnog: Xenotropic and polytropic retrovirus receptor 1(COG5409)
• Kegg: Link to kegg annotations (DDB_G0290647)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413407.1)
• Pfam: EXS family (PF03124.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;