Protein coding transcript 821

• Transcript: Ll_transcript_325436
• CDS coordinates: 1-696 (+)
• Peptide sequence: LKFLYPLQKMALTTSFSHTSILKHCSGFNGRVSSSNSSSLMGSPVTLLHYMLPGNQSHCRKQFVVFSRKLAGLEEAMKIKRERELQVVTKVKRRPPLRRGRVSPQLPVPDQIPRPPYVGSNILPEIASEHQTHDSEGIVHMRAACELAARVLKHAGTLVRPSVTTNEIDKAVHQMIIDAGAYPSPLGYGGFPKSVCTSVNECMCHGIPDSRQLQNGDIINIDVTVYLNVCF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_325436

• Blastp: Methionine aminopeptidase 1B, chloroplastic from Arabidopsis with 70.47% of identity
• Blastx: Methionine aminopeptidase 1B, chloroplastic from Arabidopsis with 71.05% of identity
• Eggnog: Removes the N-terminal methionine from nascent proteins (By similarity)(COG0024)
• Kegg: Link to kegg annotations (AT1G13270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462165.1)
• Pfam: Metallopeptidase family M24 (PF00557.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;