Transcript | Ll_transcript_532764 |
---|---|
CDS coordinates | 191-757 (+) |
Peptide sequence | MQSKSETNPTRSDPHSFQPNNVYAEPWWRGIGYNPIAQTISGANATKSSSLDCPNGDSESNEGQSLSNSGLNEEDDSAAKDSQLAAPNQTENFGHEQQGMQQTSAPAPSVREDAHTQTPQLELVGHSIVSLCLHCYYVFDLKSPVVNITTLFNSIKLCLIAYSCITFGGHSIIIEQTVAPCFWNGWDF* |
ORF Type | complete |
Blastp | Nuclear transcription factor Y subunit A-1 from Arabidopsis with 40% of identity |
---|---|
Blastx | Nuclear transcription factor Y subunit A-1 from Arabidopsis with 74.68% of identity |
Eggnog | Nuclear transcription factor Y(COG5224) |
Kegg | Link to kegg annotations (AT5G12840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014518789.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer