Protein coding transcript 82198

• Transcript: Ll_transcript_532765
• CDS coordinates: 212-856 (+)
• Peptide sequence: MRSKSETNQISSDAHSFQPSNDYAEPWWHGIGYNPIAQTLSVANTTNSSSLDCPNGDSESNEASQSLSNSRVNEEDHGTTKDSQIAAPNQSENYGQDHQGVQHTSASAPFMRKGGQTQTPQLELVGHSIACGTNPYQDPCYGGVMSAYGHQQLGYAPIMGMPHARMPLPLEMTQEPVYVNAKQYKGILRRRQARAKAELERKLIKSRKVQMHYI*
• ORF Type: complete

Annotations of Ll_transcript_532765

• Blastp: Nuclear transcription factor Y subunit A-1 from Arabidopsis with 49.53% of identity
• Blastx: Nuclear transcription factor Y subunit A-1 from Arabidopsis with 51.52% of identity
• Eggnog: Nuclear transcription factor Y(COG5224)
• Kegg: Link to kegg annotations (AT5G12840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449883.1)
• Pfam: CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B (PF02045.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;