Protein coding transcript 82372

• Transcript: Ll_transcript_533350
• CDS coordinates: 2006-2416 (+)
• Peptide sequence: MTAEPSIIIRKLEPEDLFLIFASDGLWEQLSDEAAVNIVFKYPRAGIAKRLVRTALQKAAKKREMRYDDIKKIDKGIRRHFHDDITVIVIFLDHQGGSSHGRFKQTAVGCTTAPADIFSLNAEEAEAEKSMLSSVG*
• ORF Type: complete

Annotations of Ll_transcript_533350

• Blastp: Probable protein phosphatase 2C 63 from Arabidopsis with 68.99% of identity
• Blastx: Probable protein phosphatase 2C 63 from Arabidopsis with 71.63% of identity
• Eggnog: Phosphatase(COG0631)
• Kegg: Link to kegg annotations (AT4G33920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428796.1)
• Pfam: Protein phosphatase 2C (PF00481.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;